PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 260aa    MW: 28413.6 Da    PI: 4.4124
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29367genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY51.61.9e-162072432359
               EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY  23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               sY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
  EMT29367 207 SYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHP 243
               9***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007747.7E-9200244IPR003657WRKY domain
SuperFamilySSF1182908.24E-13206244IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-14206243IPR003657WRKY domain
PROSITE profilePS5081115.021207243IPR003657WRKY domain
PfamPF031061.2E-11207243IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAYCLPNLSV PDHYYTTPVP LSPLQLPFHP KPLQMPFDQE EALMLSSDHC GLYPLPALPF  60
GGGPSPAAPA TVCEKPTVGF MPNIEAEEVG TSVTARVGYE GVTACNGYSS NTWVQVEGLD  120
DVGGGEGEDE GEEEDEGAEV LLPDQKRRGC AGRWLQVEEI RAEGCQEQSP SQINTEGLTE  180
FCSIIWKRKS SKPSISSGAN LLLSDWSYFR CTHSNCRVKK RVERLSTDCR MVITTYEGRH  240
THPPCDDNSS SSGDNTTTCF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0981493e-67FP098149.1 Phyllostachys edulis cDNA clone: bphyem124o14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572766.31e-54PREDICTED: probable WRKY transcription factor 12
TrEMBLM8CPD60.0M8CPD6_AEGTA; Putative WRKY transcription factor 12
STRINGMLOC_12078.16e-89(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.15e-18WRKY family protein